Huitres au Champagne
frenchoysterpescatarianchampagneshellfishadvancedquickappetizer

Huitres au Champagne

These oysters are barely poached in a buttery Champagne broth until just tender, then dressed with a sharp shallot mignonette. The result is delicate, briny, and refined, with bright citrus and parsley lifting every bite.

15 min
2 servings
126 kcal
French

Ingredients

Huitres et pochage

  • 12 largelive oysters, scrubbed
  • 250 mlChampagne
  • 100 mlwater
  • 1/2, juicedlemon
  • 15 gunsalted butter

Mignonette a l'echalote

  • 40 gshallot, very finely minced
  • 20 mlChampagne vinegar
  • 1/2 tspblack pepper, freshly cracked
  • 1/8 tspfine sea salt

Finition

  • 1 tbspflat-leaf parsley, very finely chopped
  • 1/4 tsplemon zest
  • a pinchblack pepper, freshly cracked
  • a small pinchflaky sea salt

Instructions

  1. 1

    Set a medium saucepan over high heat with the Champagne, water, lemon juice, and butter and bring just to a lively simmer. Meanwhile, in a small bowl, stir together the minced shallot, Champagne vinegar, 1/2 tsp black pepper, and fine sea salt to make the mignonette; let it stand briefly so the shallot softens and loses some raw harshness.

  2. 2

    Carefully shuck the oysters over a bowl to catch all their liquor. Detach each oyster from the shell, keeping the deeper bottom shells for serving if desired. Strain the oyster liquor through a fine sieve into the simmering poaching liquid; discard any shell fragments. A clean strain keeps the poaching liquor elegant rather than gritty.

  3. 3

    Lower the heat so the liquid is barely trembling, not boiling. Slip in the oysters and poach for 20 to 30 seconds only, in batches if needed, until the edges just begin to ruffle and the centers remain plump. Overcooking makes them firm and chalky, so remove them as soon as they turn glossy and lightly set.

  4. 4

    Arrange the warm oyster shells on a bed of coarse salt or a folded towel for stability, or use warmed spoons if not serving in shell. Return one oyster to each shell, spoon over a few drops of hot poaching liquor, then top each with a little shallot mignonette.

  5. 5

    Finish with the parsley, lemon zest, a pinch of black pepper, and a tiny pinch of flaky sea salt. Serve immediately while the oysters are just warm and the contrast between the delicate poach and sharp mignonette is at its best.

Nutrition per serving

126 kcal
Calories
8g
Protein
5g
Carbs
4g
Fat
0g
Fiber

Notes

Background

Oysters with mignonette are a classic expression of French seafood service, especially in coastal brasseries and festive holiday meals. Adding Champagne and a brief poach gives the dish a more luxurious, restaurant-style touch while staying rooted in the French love of pairing shellfish with wine and shallot.

Love this recipe?

Get personalised AI-curated recipes, meal plans and smart shopping lists — free.

Download Gourmate – Free