Kavum
srilankanveganrice-flourdeep-friedfestivalsweetsesame

Kavum

Kavum are crisp-edged, deep golden oil cakes with a tender, slightly chewy centre and a rich caramel sweetness from kithul treacle. Coconut milk and sesame add warmth and nuttiness, making them deeply fragrant and especially satisfying with a cup of tea.

30 min
2 servings
681 kcal
SriLankan

Ingredients

Batter

  • 160 grice flour
  • 120 mlthick coconut milk
  • 90 mlkithul treacle
  • 1 pinchfine sea salt
  • 1/4 tspground cardamom

For shaping and frying

  • 1 tbspwhite sesame seeds
  • 700 mlneutral oil for deep-frying

Instructions

  1. 1

    In a medium bowl, whisk together the rice flour, thick coconut milk, kithul treacle, salt, and cardamom until you have a smooth, thick batter with no dry pockets. It should be thicker than pancake batter and slowly drop from a spoon; if it seems too stiff to pipe or spoon, loosen with 1-2 teaspoons water, but keep it dense so the kavum hold their shape.

  2. 2

    Let the batter rest for 5 minutes. This short rest hydrates the rice flour and makes shaping easier. Meanwhile, line a plate with kitchen paper and set a small bowl of water nearby to moisten your spoon if needed.

  3. 3

    Stir the sesame seeds into the batter. Heat the neutral oil in a small, deep saucepan over medium heat to about 160-165°C. The moderate temperature is important: too hot and the outside browns before the centre cooks; too cool and the kavum absorb excess oil.

  4. 4

    To shape, scoop about 2 tablespoons of batter and gently ease it into the hot oil, helping it off the spoon with a wet fingertip or a second spoon. Fry 3 pieces at a time so the pan is not crowded. As each piece puffs and the edges begin to set, use two spoons to nudge in the sides slightly, creating the characteristic diamond-like, pinched shape.

  5. 5

    Fry each batch for 4-5 minutes total, turning occasionally, until deep golden brown and cooked through. Properly done kavum feel light for their size and show no wet batter at the seams when lifted. Adjust the heat as needed to keep the oil in range.

  6. 6

    Lift out the kavum with a slotted spoon and drain on the lined plate. Let them sit for 2-3 minutes before serving; the crust firms slightly as they cool. Serve warm or at room temperature.

Nutrition per serving

681 kcal
Calories
5g
Protein
66g
Carbs
44g
Fat
2g
Fiber

Notes

Background

Kavum is one of Sri Lanka's best-known traditional sweetmeats, especially associated with Sinhala and Tamil New Year celebrations. Made from rice flour and treacle, it reflects the island's long-standing use of rice, coconut, and palm sweeteners in festive cooking. Many households have their own shaping and seasoning variations passed down through generations.

Love this recipe?

Get personalised AI-curated recipes, meal plans and smart shopping lists — free.

Download Gourmate – Free