Bánh Canh Cua
vietnamesenoodle-soupcrabshrimppescatarianweeknightseafood

Bánh Canh Cua

This bowl of bánh canh cua is rich yet clean, with springy thick noodles in a savory seafood broth scented with shallot, garlic, and fish sauce. Sweet crab, tender shrimp, and delicate white fish make it deeply satisfying, while scallions, herbs, and lime keep it bright.

45 min
2 servings
707 kcal
Vietnamese

Ingredients

Nước dùng hải sản

  • 15 mlneutral oil
  • 60 gshallot, finely sliced
  • 12 ggarlic, minced
  • 1.2 litreswater
  • 500 mlfish stock or light seafood stock
  • 30 mlfish sauce
  • 4 gsalt
  • 1 gwhite pepper
  • 8 grock sugar

Hải sản

  • 180 gfresh crab meat
  • 160 graw shrimp, peeled and deveined
  • 120 gfirm white fish fillet, cut into bite-size pieces

Bánh canh và hoàn thiện

  • 400 gudon noodles
  • 25 gscallions, finely sliced
  • 10 gcilantro leaves
  • 15 gfried shallots
  • 1 limelime, cut into wedges
  • 10 mlground annatto or paprika oil

Instructions

  1. 1

    Prepare all ingredients first: slice the shallot, mince the garlic, peel and devein the shrimp, cut the fish into bite-size pieces, slice the scallions, and bring a pot of water to a boil for the noodles. Keeping the seafood in even pieces helps everything cook quickly and stay tender.

  2. 2

    Heat the oil in a soup pot over medium heat. Add the shallot and cook for 2-3 minutes until softened and lightly golden, then add the garlic and stir for 30 seconds until fragrant; do not let it brown deeply or the broth can taste bitter.

  3. 3

    Pour in the water and fish stock. Season with fish sauce, salt, white pepper, and rock sugar. Bring to a gentle boil, then lower to a steady simmer for 10 minutes so the aromatics infuse the broth.

  4. 4

    Meanwhile, cook the udon noodles in boiling water according to package directions, usually 2-4 minutes for vacuum-packed noodles or slightly longer if chilled. Loosen them gently with chopsticks, then drain and rinse briefly with warm water to remove excess starch and prevent clumping.

  5. 5

    Add the fish pieces to the simmering broth and cook for about 2 minutes. Add the shrimp and cook for 1-2 minutes more, just until the shrimp turn pink and the fish is opaque. Finally, add the crab meat and simmer for 1 minute only, just to heat through; overcooking will toughen the seafood.

  6. 6

    Taste the broth and adjust if needed: it should be savory, lightly sweet, and distinctly marine. Stir in half of the scallions and the annatto or paprika oil for a warmer color and a subtle aromatic finish.

  7. 7

    Divide the cooked udon noodles between 2 large bowls. Ladle the hot seafood broth over the noodles, making sure each bowl gets crab, shrimp, and fish. Top with the remaining scallions, cilantro, and fried shallots. Serve immediately with lime wedges on the side for squeezing at the table.

Nutrition per serving

707 kcal
Calories
59g
Protein
70g
Carbs
20g
Fat
3g
Fiber

Notes

Background

Bánh canh cua is a beloved Vietnamese noodle soup built around thick, chewy noodles and a rich crab-based broth. Versions vary by region and household, with some including pork, quail eggs, or a thicker, more gelatinous soup, but seafood-forward styles are especially popular in southern Vietnam.

Love this recipe?

Get personalised AI-curated recipes, meal plans and smart shopping lists — free.

Download Gourmate – Free