Kimchijeon
koreankimchipancakevegetarianpan-friedquickbeginner

Kimchijeon

Kimchijeon is a crisp-edged, savory Korean pancake packed with tangy kimchi and sweet spring onion. The center stays tender while the outside turns golden and crackly, especially when dipped into a nutty sesame-soy sauce.

15 min
2 servings
307 kcal
Korean

Ingredients

Pancake batter

  • 180 gkimchi, chopped
  • 80 gplain flour
  • 1 largeegg
  • 2spring onion, thinly sliced
  • 70 mlcold water
  • 30 mlkimchi juice
  • 5 mlsoy sauce
  • 5 mlsesame oil

For frying

  • 15 mlneutral oil

Dipping sauce

  • 15 mlsoy sauce
  • 10 mlrice vinegar
  • 5 mlsesame oil
  • 5 gtoasted sesame seeds
  • 1spring onion, finely sliced

Instructions

  1. 1

    Chop the kimchi into bite-size pieces, thinly slice the spring onions, and set a small nonstick or well-seasoned frying pan over medium-high heat so it gets properly hot before the batter goes in. A hot pan helps the pancake crisp instead of steaming.

  2. 2

    In a medium bowl, whisk together the plain flour, egg, cold water, kimchi juice, soy sauce, and sesame oil until just smooth. Fold in the chopped kimchi and sliced spring onion. The batter should be loose enough to spread but thick enough to hold the kimchi evenly; if it seems very stiff, add 1 teaspoon extra water.

  3. 3

    In a small bowl, stir together the soy sauce, rice vinegar, sesame oil, toasted sesame seeds, and finely sliced spring onion for the dipping sauce. Set aside so the flavors meld while the pancake cooks.

  4. 4

    Add the neutral oil to the hot pan and swirl to coat. Pour in the batter and spread it into a roughly 18-20 cm round. Cook for 3-4 minutes over medium-high heat until the underside is deep golden brown and crisp at the edges. Reduce the heat slightly if it darkens too fast before setting.

  5. 5

    Flip the pancake carefully with a wide spatula and cook for 3-4 minutes more until the second side is golden, the center feels set, and some kimchi edges are lightly caramelized. For extra crispness, press gently with the spatula during the last minute.

  6. 6

    Slide the kimchijeon onto a board, rest for 1 minute so the crust stays crisp, then cut into wedges and serve immediately with the dipping sauce.

Nutrition per serving

307 kcal
Calories
8g
Protein
29g
Carbs
16g
Fat
2g
Fiber

Notes

Background

Kimchijeon is a classic Korean home-style pancake made by mixing kimchi into a simple flour batter and pan-frying it until crisp. It has long been a practical way to use ripe kimchi, and it remains a popular snack, side dish, and anju served with drinks.

Love this recipe?

Get personalised AI-curated recipes, meal plans and smart shopping lists — free.

Download Gourmate – Free